🟢 All systems operational · Independent live monitoring · No paid rankings
+ Add Provider
.com $28.84 for 3 yrs
·
.net $33.60 for 3 yrs
·
.org $29.43 for 3 yrs
·
.io $131.72 for 3 yrs
·
.co $67.08 for 3 yrs
·
.me $39.76 for 3 yrs
·
.cloud $34.67 for 3 yrs
·
.ai $239.94 for 3 yrs
·
.dev $33.12 for 3 yrs
·
.app $37.26 for 3 yrs
·
.xyz $29.40 for 3 yrs
·
.tech $108.66 for 3 yrs
·
.shop $62.80 for 3 yrs
·
.online $31.14 for 3 yrs
·
.site $31.14 for 3 yrs
·
.store $41.94 for 3 yrs
·
.info $46.59 for 3 yrs
·
.biz $43.74 for 3 yrs
·
.pro $46.07 for 3 yrs
·
.blog $41.81 for 3 yrs
·
.us $17.10 for 3 yrs
·
.uk $16.26 for 3 yrs
·
.ca $27.05 for 3 yrs
·
.de $8.70 for 3 yrs
·
.eu $17.04 for 3 yrs
·

Spaceship

United States
Domains, hosting and cloud from the team behind Namecheap — around 500 domain extensions with free WHOIS privacy, cPanel Web Hosting, EasyWP, AMD EPYC VPS and Spacemail
7.1/10 DHH Score Founded 2022 HQ Phoenix, Arizona, United States Updated Oct 1, 2026
Best for Domain portfoliosSmall-business websitesWordPress sitesDevelopers & side projectsBusiness emailBudget VPS
Uptime 30d
99.25%
SLA 99.99% monthly on Web Hosting & EasyWP (Spaceship's own guarantee)
From
$1.66
renews $2.41
Avg response
264 ms
global · 30d
DHH Score
7.1/10
Money-back
30 d
guarantee
domainscheap-domainsfree-whois-privacyicann-accreditedcpanellitespeedeasywpmanaged-wordpressvpsamd-epycnvmepay-as-you-gohyperliftbusiness-emailai-website-buildercdnvpnnamecheapfree-trialcrypto-payments
$1.66 /mo
⚠ then $2.41/mo at renewal
Web Hosting Essential · 20 GB NVMe · Unlimited traffic
check_circle Free SSL + email included
check_circle Free website migration
check_circle 30-day money-back guarantee
Affiliate link · DohoHub may earn a commission at no extra cost to you. Price tracked live.
lock
Free SSL + email
included
bolt
LiteSpeed
server-level caching
backup
Backups
daily (autobackup, paid add-on)
support_agent
24/7 support
24/7 live chat & email
verified_user
Money-back
30-day guarantee
sell

Plans & pricing

26 plans tracked · prices checked an hour ago
You pay (intro)$1.66/mo
arrow_forward
Renews at$2.41/mo
▲ +45% at renewal
# Plan Specs Price
1 Web Hosting Essential★ Cheapest 20 GB NVMEUnlimited traffic $1.66/mo then $2.41/mo Get →
2 Web Hosting Pro 50 GB NVMEUnlimited traffic $2.41/mo then $4.07/mo Get →
3 Web Hosting Supreme Unlimited NVME storageUnlimited traffic $3.24/mo then $5.74/mo Get →
# Plan Specs Price
1 VPS Standard 1★ Cheapest 1 vCPU AMD EPYC 77422 GB RAM25 GB NVME1 TB traffic1 Gbps $4.90/mo Get →
2 VPS CPU-optimized 1 2 vCPU AMD EPYC 77422 GB RAM25 GB NVME4 TB traffic1 Gbps $7.91/mo Get →
3 VPS Standard 2 2 vCPU AMD EPYC 77424 GB RAM60 GB NVME2 TB traffic1 Gbps $11.90/mo Get →
4 VPS CPU-optimized 2 4 vCPU AMD EPYC 77424 GB RAM60 GB NVME5 TB traffic1 Gbps $15.89/mo Get →
5 VPS Memory-optimized 1 2 vCPU AMD EPYC 77428 GB RAM50 GB NVME4 TB traffic1 Gbps $22.89/mo Get →
6 VPS Standard 3 4 vCPU AMD EPYC 77428 GB RAM160 GB NVME4 TB traffic1 Gbps $25.89/mo Get →
7 VPS CPU-optimized 3 8 vCPU AMD EPYC 77428 GB RAM100 GB NVME6 TB traffic1 Gbps $30.90/mo Get →
8 VPS Memory-optimized 2 4 vCPU AMD EPYC 774216 GB RAM100 GB NVME6 TB traffic1 Gbps $44.89/mo Get →
9 VPS Standard 4 8 vCPU AMD EPYC 774216 GB RAM320 GB NVME6 TB traffic1 Gbps $52.90/mo Get →
You pay (intro)$5.88/mo
arrow_forward
Renews at$9.88/mo
▲ +68% at renewal
# Plan Specs Price
1 EasyWP Starter★ Cheapest 10 GB NVMEUnlimited traffic $5.88/mo then $9.88/mo Get →
2 EasyWP Turbo 50 GB NVMEUnlimited traffic $9.88/mo then $18.88/mo Get →
3 EasyWP Supersonic 100 GB NVMEUnlimited traffic $12.88/mo then $26.88/mo Get →
# Plan Specs Price
1 Spacemail Pro (1 mailbox)★ Cheapest 5 GB $0.79/mo Get →
2 Spacemail Business (3 mailboxes) 10 GB $1.20/mo then $1.66/mo Get →
3 Spacemail Advanced (5 mailboxes) 15 GB $1.86/mo then $2.66/mo Get →
# Plan Specs Price
1 Alf Website Studio $5.00/mo Get →
# Plan Specs Price
1 Volume 50 GB★ Cheapest 50 GB NVME BLOCK VOLUME $3.50/mo Get →
2 Volume 100 GB 100 GB NVME BLOCK VOLUME $7.00/mo Get →
3 Volume 250 GB 250 GB NVME BLOCK VOLUME $17.50/mo Get →
4 Volume 500 GB 500 GB NVME BLOCK VOLUME $35.00/mo Get →
# Plan Specs Price
1 Load Balancer Basic★ Cheapest 1 CPU AMD1 GB RAM1 TB traffic1 Gbps $4.90/mo Get →
2 Load Balancer Standard 2 CPU AMD4 GB RAM5 TB traffic1 Gbps $22.89/mo Get →
3 Load Balancer Premium 4 CPU AMD8 GB RAM10 TB traffic1 Gbps $44.89/mo Get →
checklist

What's included

✓ included · $ paid add-on · ✗ not offered
Essentials
check_circleFree SSL
cancelFree domain
check_circleFree email
check_circleFree migration
check_circle1-click WordPress
check_circleWebsite builder
Performance
check_circleNVMe SSD
check_circleLiteSpeed + cache
Security
check_circleDDoS protection
check_circleWeb App Firewall
check_circleMalware scanner
check_circle2FA
Management
check_circleControl panel
check_circleSSH / Git
check_circleRoot access
check_circlecPanel
speed

Performance & reliability

monitored every 5 min · last 30 days
Daily uptime — 30 days
▲ 99.25%
OperationalDegradedOutage
Response time — 30 days
⚡ 264 ms avg
<300ms300–500ms>500ms
public

Global data centers

4 locations
Phoenix (United States) United Kingdom Singapore (Singapore)
Phoenix United StatesSingapore SingaporeUnited Kingdom United KingdomEurope
shield

Security & compliance

shield
Free WHOIS privacy
included
shield
DNSSEC
included
gpp_good
DNS DDoS protection
included
phonelink_lock
2FA & passkeys
included
shield
Imunify360 (hosting)
included
shield
CloudLinux CageFS
included
lock
Free Let's Encrypt SSL
included
pest_control
EasyWP HackGuardian & MalwareGuardian
included
shield
Spacemail storage encryption
included
support_agent

Support & guarantees

Channels24/7 live chat & email
Avg first replyLive chat & email, 24/7 (Spaceship's own description)
Knowledge baseKnowledge base + Alf AI assistant in the dashboard
Uptime SLA99.99% monthly on Web Hosting & EasyWP (Spaceship's own guarantee)
Money-back30 days
apartment

Company & billing

Founded2022
HeadquartersPhoenix, Arizona, United States
NetworkWeb Hosting: US, UK, EU and Singapore data centers · VPS: Phoenix and Singapore, up to 1 Gbps per VM
PaymentVisa, Mastercard, American Express, Discover, Diners Club, JCB, UnionPay, PayPal, Apple Pay, Google Pay, Alipay, Bitcoin, Account funds
BillingHosting & email: monthly, yearly or 2 years · VPS: hourly pay-as-you-go or prepaid monthly, quarterly, yearly · Domains: 1–10 years
Free trial30 days on Web Hosting, EasyWP, Spacemail, CDN, FastVPN, Alf; 7 days on VPS Volumes, Load Balancer, Mail Bridge, AutoBackup
Refund policy30-day money-back on first-time non-trial Web Hosting & prepaid Cloud; renewals within 48 h; new domains within 5 days (discretionary); crypto payments non-refundable
ServicesShared Hosting, WordPress, VPS, Email Hosting, Domain registrar, Website Building, Storage, CDN, VPN, AI Solutions, cPanel Hosting, Backup Solutions
monitoring

Price history

cheapest plan · tracked by DohoHub · 1 months
$1.66/mo ▼ 0% vs 1 mo ago Lowest seen: $1.66 · Highest: $1.66
Sep '26Sep '26
balance

Pros, cons & verdict

apartment

About Spaceship

Spaceship is a domain registrar and web-services platform built by the team behind Namecheap. Spaceship, Inc. is an ICANN-accredited registrar (IANA ID 3862) based at 4600 East Washington Street in Phoenix, Arizona. The company says it has been serving customers since 2022; Namecheap announced the platform's public beta in August 2023, with founder and CEO Richard Kirkendall at its head, and in June 2024 Spaceship reported passing one million domains under management. Spaceship and its Unbox™ feature are trademarks of Namecheap, Inc.

Domains are the core of the platform: around 500 extensions, each with its own registration, renewal and transfer price, free WHOIS privacy through Withheld for Privacy on nearly all of them, DNSSEC, custom nameservers, premium domains and SellerHub, a marketplace for listing and selling your own names. A transfer costs one year of renewal, and that year is added to the existing registration. Spaceship lists domain prices without ICANN's $0.20 annual fee, which it adds at checkout on generic extensions such as .com, .net and .org.

Around the domains sits a full hosting line-up:

  • Web Hosting — cPanel plans (Essential, Pro, Supreme) on LiteSpeed with NVMe storage, unmetered bandwidth, Imunify360 and free Spacemail mailboxes for the first year, in US, UK, EU or Singapore data centers.
  • EasyWP — managed cloud hosting for WordPress with its own dashboard instead of cPanel, three caching layers and the HackGuardian and MalwareGuardian security tools.
  • VPS — nine KVM configurations on AMD EPYC 7742 with DDR4 ECC memory and NVMe storage, in Phoenix or Singapore, billed by the hour or prepaid monthly, quarterly or yearly, with block-storage Volumes, load balancers, Mail Bridge for outbound email and AutoBackup as add-ons.
  • Hyperlift — a container platform that builds and deploys apps straight from a GitHub repository and a Dockerfile.
  • Spacemail business email, the Supersonic CDN, the FastVPN service and Alf Website Studio, an AI website builder.

Spaceship's pitch is simplicity: Unbox™ connects a domain to the hosting or email bought with it without manual DNS work, and most products start with a free trial and a discounted first billing cycle. That keeps entry prices low, but renewals are higher, and for hosting the 30-day money-back guarantee covers only first-time purchases made without a trial.

Support works by live chat and email (support@spaceship.com) — Spaceship describes the team as ready 24/7 — alongside Alf, an AI assistant built into the dashboard, and a knowledge base. Payment options include major cards, PayPal, Apple Pay, Google Pay, Alipay and Bitcoin.

thumb_upPros

addAround 500 domain extensions with free WHOIS privacy (Withheld for Privacy) on nearly all of them, plus DNSSEC and custom nameservers
addRegistration, renewal and transfer prices published for every extension; a transfer adds a year to the registration
addOne account for domains, hosting, email and cloud — Unbox™ connects them without manual DNS work
addFree 30-day trials on Web Hosting, EasyWP, Spacemail, the CDN, FastVPN and Alf Website Studio
addcPanel Web Hosting on LiteSpeed with NVMe storage, unmetered bandwidth and Imunify360, in US, UK, EU or Singapore data centers
addHourly pay-as-you-go or prepaid VPS on AMD EPYC with NVMe; prepaid yearly terms cost less than hourly billing
addWide payment choice: cards, PayPal, Apple Pay, Google Pay, Alipay and Bitcoin
addLive chat and email support, and a 99.99% monthly uptime guarantee on Web Hosting and EasyWP

thumb_downCons

removeHosting promos cover the first billing cycle only — Web Hosting and EasyWP renew noticeably higher
removeMany new-extension domain promos are first-year only; renewals can cost several times the first-year price
removeA $0.20 ICANN fee per year is added at checkout on generic extensions such as .com, .net and .org
removeTrial-based hosting isn't eligible for the 30-day money-back guarantee; new domains are refundable only within 5 days, at Spaceship's discretion
removeVPS only in Phoenix and Singapore, with outbound port 25 closed unless you buy Mail Bridge
removeEasyWP hosts one WordPress site per plan, in a US data center only, and has no cPanel
removeNo phone support — live chat and email only
removeA young brand (public beta in 2023): some products are still filling out, and CDN features such as the WAF are marked 'coming soon'
7.1/10
auto_awesomeDohoHub verdict

Spaceship is strongest as a registrar. Around 500 extensions come with published registration, renewal and transfer prices, WHOIS privacy is free on nearly all of them, and the account side is modern: DNSSEC, passkeys, a marketplace for your own names and Unbox™, which wires domains to hosting and email without touching DNS. Watch the small print every registrar has — first-year promos on new extensions, and the $0.20 ICANN fee added at checkout.

On hosting it is a capable, low-priced all-rounder from the Namecheap stable: cPanel Web Hosting on LiteSpeed in four regions, managed WordPress on EasyWP, and hourly or prepaid AMD EPYC VPS with volumes, load balancers and a container platform around them. The catch is the trial-and-promo model — first billing cycles are cheap, renewals are not, and trial-based hosting sits outside the 30-day money-back guarantee — so compare the renewal price, not the headline, before committing to a long term.

leaderboard

DHH Score

How it is calculated →
7.1/10
Computed from data we collected ourselves: live prices, renewal terms, facts documented from Spaceship's own pages and our uptime monitor. Nobody types this number in, and nothing a company pays us changes it. Parts with data this time: 90% of the formula; a part without data is left out, not counted as zero. Updated Oct 1, 2026.
Price 30%7.0
Plans compared with other companies selling the same kind of plan at the same size
Long-term price 20%7.6
How far the regular price (renewal or month-to-month) is above the advertised one
What's included 25%5.3
What plans include and what the company guarantees, documented from its own pages
Reliability 15%9.7
Uptime and response time of the company's website, measured by our monitor
Users 10%not enough data
Approved user reviews (from 5) and community votes (from 20)
Product linePlansPrice vs marketLong-term priceWhat's included
Shared Hosting 3 8.9 · cheapest plan vs 28 other companies 5.2 · regular price ×1.69 6.3 · 7 of 11 checks known
WordPress 3 4.4 · cheapest plan vs 20 other companies 4.1 · regular price ×1.91 6.3 · 7 of 11 checks known
Website Building 1 no comparable market yet renewal price not tracked 4.0 · 1 of 2 checks known
Email Hosting 3 10.0 · cheapest plan vs 12 other companies 6.9 · regular price ×1.41 4.0 · 1 of 2 checks known
Cloud VPS 9 6.1 · 9 plans vs 34 other companies 10.0 · no increase too few documented facts (3 of 9)
Storage 4 no like-for-like plan to compare 10.0 · no increase too few documented facts (1 of 6)
Load Balancers 3 no comparable market yet 10.0 · no increase 4.0 · 1 of 2 checks known
Documented facts · what Spaceship states on its own pages; we record the page and the date we checked it
check_circle
Free trial Web hosting: Yes — 30 days free
Source: spaceship.com · checked Sep 27, 2026
check_circle
Support: 24/7 — 24/7 support team
Source: spaceship.com · checked Sep 27, 2026
cancel
Backups Web hosting: Paid add-on — AutoBackup is an add-on
Source: spaceship.com · checked Sep 27, 2026
check_circle
Free SSL Web hosting: Yes — Let's Encrypt, no renewal fee
Source: spaceship.com · checked Sep 27, 2026
check_circle
Free migration Web hosting: Yes — Migration is free
Source: spaceship.com · checked Sep 27, 2026
cancel
Email accounts included Web hosting: No — Mailboxes free for the first year only
Source: spaceship.com · checked Sep 27, 2026
check_circle
Renewal price Load Balancers: Same as the first term — After the trial each plan renews at the same monthly price
Source: spaceship.com · checked Sep 28, 2026
check_circle
Renewal price Storage: Same as the first term — Free trial, then the listed price; prepaid volumes are charged at a fixed rate
Source: spaceship.com · checked Sep 28, 2026
check_circle
Renewal price Cloud VPS: Same as the first term — Prepaid VPS are charged at a fixed rate; pay-as-you-go is billed hourly
Source: spaceship.com · checked Sep 28, 2026
cancel
Renewal price Web hosting: Higher after the first term — e.g. $19.88/yr after the trial, renews at $28.88/yr
Source: spaceship.com · checked Sep 27, 2026
compare_arrows

Compare vs similar

*DHH Score, 0–10 — computed by DohoHub · «—» = not tracked yet
ProviderFromRenewalUptimeDatacentersFree domainBackupsSupportDHH*
Spaceship $1.66 $2.41 99.25% 4 regions ✗ Daily (AutoBackup, paid add-on) 24/7 live chat & email 7.1
SSD Nodes $5.50 $3.25 99.83% 14 regions — On demand (snapshots) 24/7 Ticket, Email, Knowledge Base 8.3
Database Mart $2.88 — 99.70% 3 regions — Daily 24/7 Live Chat, Ticket System 8.1
Linveo $4.00 $2.00 99.64% 2 regions — Continuous (shared) · On demand (VPS) · included Live chat + tickets (no SLA) 7.9
GPU Mart $21.00 $29.00 99.86% 2 regions — Bi-weekly (VPS); add-on (dedicated) 24/7 Ticket & Live Chat 7.6
xCloud $0.00 $0.00 99.75% 31 regions — Daily automated (server + sites) 24/7 Live Chat & Ticket 7.6
reviews

User reviews

✎ Be the first to review
No reviews yet — share your experience and help others choose the right hosting.
forward_to_inboxRequest a Quote

Fill out this form and Spaceship will get back to you with a personalized offer.

lock Your email is only shared with Spaceship.

quiz

Frequently asked questions

What does Spaceship sell?expand_more
Domains first — around 500 extensions, plus premium domains and SellerHub, a marketplace for selling your own names. Around them: cPanel Web Hosting, EasyWP managed WordPress hosting, VPS with block-storage Volumes, load balancers, Mail Bridge and AutoBackup add-ons, Hyperlift (a container platform for apps deployed from GitHub), Spacemail business email, the Supersonic CDN, the FastVPN service and Alf Website Studio, an AI website builder. Everything is managed from one Spaceship account.
How much does a .com domain cost at Spaceship?expand_more
When we checked in September 2026, a new .com cost $8.88 for the first year, $9.98 a year to renew and $9.48 to transfer in (a transfer includes a one-year renewal). Spaceship lists prices without ICANN's mandatory $0.20 annual fee, which it adds at checkout on .com and other generic extensions. Registrations run from 1 to 10 years. DohoHub tracks the registration, renewal and transfer price of every Spaceship extension daily on its registrar page.
Is WHOIS privacy free at Spaceship?expand_more
Yes, for nearly all extensions. Spaceship adds privacy protection from Withheld for Privacy automatically when you register a domain, and on eligible transfers, free for life. Public WHOIS lookups then show redacted, anonymized data instead of your name, address and contact details.
How do domain transfers to Spaceship work?expand_more
You pay for one year of renewal, and that year is added to the domain's current expiration date, so no registration time is lost. Get the authorization (EPP) code from your current registrar, remove the registrar lock if it is set, then start the transfer at Spaceship and enter the code. Spaceship says transfers normally complete in about 30 minutes and take no longer than five days, and free privacy protection applies to eligible transferred domains. Some extensions, such as .co.uk and .uk, carry no transfer fee.
What do the Web Hosting plans include?expand_more
Three cPanel plans on LiteSpeed web servers with CloudLinux and Imunify360: Essential (20 GB of NVMe storage, 5 domains, up to 1 CPU core and 1 GB of memory), Pro (50 GB, unlimited domains, 2 cores, 2 GB) and Supreme (unmetered NVMe storage, unlimited domains, 4 cores, 3 GB). All include unlimited websites, unmetered bandwidth, free SSL certificates, an AI website builder and free Spacemail mailboxes — 5 per domain — for the first year; Pro and Supreme add WordPress AI Tools. You choose a US, UK, EU or Singapore data center when you order.
How much is Spaceship Web Hosting, and what does it renew at?expand_more
Prices when we checked in September 2026, after a free 30-day trial: Essential $19.88 for the first year, then $28.88 a year; Pro $28.88, then $48.88; Supreme $38.88, then $68.88. Two-year terms start at $28.88, $48.88 and $68.88 and renew at $48.88, $88.88 and $128.88 every two years. Monthly billing is $3.88, $4.88 and $6.88 a month with no first-term discount. The discount applies to the first billing cycle only.
What is EasyWP?expand_more
EasyWP is Spaceship's managed cloud hosting for WordPress: one WordPress site per plan, a custom dashboard instead of cPanel, three caching layers (PHP OPcache, object cache and response cache), SFTP and database access, free SSL and the HackGuardian and MalwareGuardian security tools. Starter has 10 GB of NVMe storage for about 50,000 monthly visits, Turbo 50 GB for 200,000 and Supersonic 100 GB for 500,000. In September 2026 monthly billing was $5.88, $9.88 and $12.88 for the first month after a 30-day trial, renewing at $9.88, $18.88 and $26.88; yearly billing was $28.88, $36.88 and $48.88 for the first year, renewing at $68.88, $114.88 and $138.88. EasyWP runs in a US data center.
What VPS plans does Spaceship offer?expand_more
Nine KVM virtual machines on AMD EPYC 7742 processors with DDR4 ECC memory and NVMe storage, in Phoenix (US) or Singapore: Standard (1–8 cores, 2–16 GB of RAM), CPU-optimized (2–8 cores) and Memory-optimized (2–4 cores with 8–16 GB). The smallest, Standard 1 — 1 core, 2 GB of RAM, 25 GB of NVMe storage and 1 TB of transfer — cost $0.007 an hour, about $4.90 a month, in September 2026. Each VM has a port of up to 1 Gbps, and Spaceship says it applies no traffic shaping by default. Optional bundles install n8n, OpenClaw, Claude Code, Codex CLI, an MCP server, CyberPanel or cPanel (licence bought separately) when the VM is deployed.
Pay-as-you-go or prepaid VPS billing — what is the difference?expand_more
Pay-as-you-go bills every hour a VM exists — running or switched off — at the end of the month, and terminating the VM stops the charges. Prepaid charges a fixed price up front for a month, a quarter or a year; for Standard 1 that was $4.90, $13.88 or $42.44 in September 2026, so the yearly term works out at about $3.54 a month. Prepaid Spaceship Cloud services are non-refundable, except first-time non-trial purchases covered by the 30-day money-back guarantee.
Can I send email from a Spaceship VPS?expand_more
Outbound SMTP port 25 is closed by default. You can use a relay on another port, a third-party sending service or Spacemail — or buy Mail Bridge ($5 a month in September 2026), which opens port 25 on one VM, lets you set a PTR record and gives the VM a reputation-verified IP. Mail Bridge does not include mailboxes or a managed mail server: you install and secure your own mail software and DNS records (SPF, DKIM, DMARC).
What is Hyperlift and how much does it cost?expand_more
Hyperlift deploys containerized apps from a GitHub repository: you point it at a Dockerfile, and it builds and deploys the app and redeploys on every push, with SSL, logs and metrics included. Sizes run from Micro (0.25 vCPU, 0.5 GB of RAM) to Extra Large (4 vCPU, 8 GB); in September 2026 pay-as-you-go prices were $0.005 to $0.073 an hour — roughly $3.60 to $52.57 a month — with prepaid monthly, quarterly and yearly terms as well. An OpenClaw AI-assistant template can be installed on Medium plans and above.
How much does Spacemail cost?expand_more
In September 2026, on two-year billing (the default on Spaceship's page): Pro — 1 mailbox with 5 GB — $18.88 per two years; Business — 3 mailboxes with 10 GB each — $28.68 for the first two years, then $39.84; Advanced — 5 mailboxes with 15 GB each — $44.69, then $63.84. Monthly billing is $0.98, $2.88 and $3.88. Extra mailboxes and storage can be added to any plan. Web Hosting includes a Special Spacemail plan with 5 mailboxes per connected domain, free for the first year and $5.88 a year after that.
Does Spaceship offer a free trial or a money-back guarantee?expand_more
Most products start with a free trial — 30 days for Web Hosting, EasyWP, Spacemail, the CDN, FastVPN and Alf Website Studio, and 7 days for VPS Volumes, load balancers, Mail Bridge and AutoBackup. The refund policy offers a 30-day money-back guarantee only on first-time, non-trial purchases of Web Hosting and prepaid Spaceship Cloud products, and hosting renewals can be refunded within 48 hours. New domain registrations may be refunded within 5 days at Spaceship's discretion, and renewals of extensions such as .ai, .ca, .eu and .gg cannot be cancelled. Spacemail can be refunded within 30 days of a first purchase, and payments made in cryptocurrency are not refundable.
Which payment methods does Spaceship accept?expand_more
Visa, Mastercard, American Express, Discover, Diners Club, JCB and UnionPay cards, PayPal, Apple Pay, Google Pay, Alipay and Bitcoin, as well as funds held in the Spaceship account. Refunds, where available, go back to the original payment method in US dollars; cryptocurrency payments cannot be refunded.
What uptime does Spaceship guarantee?expand_more
Spaceship's legal pages give a 99.99% monthly uptime guarantee for all Web Hosting plans and all EasyWP plans. For EasyWP the remedy is a free extension of the service — one day for each hour of unscheduled downtime, up to one month — claimed through support within 10 days; for Web Hosting remedies are at Spaceship's discretion. DohoHub separately measures the availability of Spaceship's own website; see the uptime figures on this page.
How is Spaceship related to Namecheap?expand_more
Spaceship was founded by Richard Kirkendall, who also founded Namecheap, and Namecheap announced the platform's public beta in August 2023; the Spaceship and Unbox™ trademarks belong to Namecheap, Inc. Spaceship, Inc. is a separate ICANN-accredited registrar (IANA ID 3862) with its own accounts, prices and products — EasyWP hosting is sold by both.
What do the Spaceship CDN and FastVPN cost?expand_more
Supersonic CDN plans are Basic (250 GB of traffic a month), Medium (500 GB) and Advanced (1,000 GB); yearly billing in September 2026 was $58.88, $118.88 and $238.88 for the first year, renewing at $88.88, $188.88 and $388.88, and monthly billing started at $7.88 for the first month, then $8.88. FastVPN cost $12 for the first year (then $34.56 a year) or $5.88 a month, with a 30-day money-back guarantee.
↑